[Debichem-commits] [SCM] massXpert mass spectrometry suite: debian packaging branch, debian, updated. upstream/3.2.0-1-g5564507

Filippo Rusconi (Debian Maintainer) rusconi-debian at laposte.net
Thu Nov 24 21:27:44 UTC 2011


The following commit has been merged in the debian branch:
commit e4678f588e1a2ebd7165cd03339ba757d214ffab
Author: Filippo Rusconi (Debian Maintainer) <rusconi-debian at laposte.net>
Date:   Wed Apr 7 21:32:13 2010 +0200

    New protein sequences.

diff --git a/data/pol-seqs/yellow-fluorescent-protein.mxp b/data/pol-seqs/cerulean-histag.mxp
similarity index 75%
copy from data/pol-seqs/yellow-fluorescent-protein.mxp
copy to data/pol-seqs/cerulean-histag.mxp
index 418a7fa..c577949 100644
--- a/data/pol-seqs/yellow-fluorescent-protein.mxp
+++ b/data/pol-seqs/cerulean-histag.mxp
@@ -26,12 +26,12 @@ Copyright 2006,2007,2008 Filippo Rusconi - Licensed under the GNU GPL -->
 ]>
 <polseqdata version="5">
   <polchemdef_name>protein-1-letter</polchemdef_name>
-  <name>CFP TEV-cut</name>
+  <name>Not Set</name>
   <code>NOT_SET</code>
-  <author>rusconi</author>
-  <datetime>2009-09-17:56:09</datetime>
+  <author>NOT_SET</author>
+  <datetime>2010-04-07:32:24</datetime>
   <polseq>
-    <codes>GAVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK</codes>
+    <codes>SYYHHHHHHDYDIPTTENLYFQGAVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTWGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNAISDNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK</codes>
   </polseq>
   <le_modif>
   </le_modif>
@@ -40,7 +40,7 @@ Copyright 2006,2007,2008 Filippo Rusconi - Licensed under the GNU GPL -->
   <crosslinks>
     <crosslink>
       <name>CFP-chromophore</name>
-      <targets>;66;67;68;</targets>
+      <targets>;88;89;90;</targets>
       <comment></comment>
     </crosslink>
   </crosslinks>
diff --git a/data/pol-seqs/yellow-fluorescent-protein.mxp b/data/pol-seqs/cyan-fluorescent-protein-h148d-histag.mxp
similarity index 76%
copy from data/pol-seqs/yellow-fluorescent-protein.mxp
copy to data/pol-seqs/cyan-fluorescent-protein-h148d-histag.mxp
index 418a7fa..1b09377 100644
--- a/data/pol-seqs/yellow-fluorescent-protein.mxp
+++ b/data/pol-seqs/cyan-fluorescent-protein-h148d-histag.mxp
@@ -29,9 +29,9 @@ Copyright 2006,2007,2008 Filippo Rusconi - Licensed under the GNU GPL -->
   <name>CFP TEV-cut</name>
   <code>NOT_SET</code>
   <author>rusconi</author>
-  <datetime>2009-09-17:56:09</datetime>
+  <datetime>2010-04-07:33:23</datetime>
   <polseq>
-    <codes>GAVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK</codes>
+    <codes>SYYHHHHHHDYDIPTTENLYFQGAVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTWGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYISDNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK</codes>
   </polseq>
   <le_modif>
   </le_modif>
@@ -40,8 +40,8 @@ Copyright 2006,2007,2008 Filippo Rusconi - Licensed under the GNU GPL -->
   <crosslinks>
     <crosslink>
       <name>CFP-chromophore</name>
-      <targets>;66;67;68;</targets>
-      <comment></comment>
+      <targets>;88;89;90;</targets>
+      <comment>NOT_SET</comment>
     </crosslink>
   </crosslinks>
 </polseqdata>

-- 
massXpert mass spectrometry suite: debian packaging



More information about the Debichem-commits mailing list